GET /api/protein/UniProt/F6PVM6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F6PVM6",
"id": "F6PVM6_MONDO",
"source_organism": {
"taxId": "13616",
"scientificName": "Monodelphis domestica",
"fullName": "Monodelphis domestica (Gray short-tailed opossum)"
},
"name": "Protein FAM162A",
"description": [
"Proposed to be involved in regulation of apoptosis; the exact mechanism may differ between cell types/tissues. May be involved in hypoxia-induced cell death of transformed cells implicating cytochrome C release and caspase activation (such as CASP9) and inducing mitochondrial permeability transition. May be involved in hypoxia-induced cell death of neuronal cells probably by promoting release of AIFM1 from mitochondria to cytoplasm and its translocation to the nucleus; however, the involvement of caspases has been reported conflictingly"
],
"length": 66,
"sequence": "MLDAAKNRFRVRVSYLMIALTILGCVIMVIQGKQAVKRHETLTSLNLERKALLRKQEEEAIKSKTD",
"proteome": "UP000002280",
"gene": "FAM162A",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1b48ad22e090a49f381d6b6a795f3eaeacb3a5ba",
"counters": {
"domain_architectures": 2437,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2437
}
}
}