"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F6PVM6"	"{'domain_architectures': 2437, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2437}"	"['Proposed to be involved in regulation of apoptosis; the exact mechanism may differ between cell types/tissues. May be involved in hypoxia-induced cell death of transformed cells implicating cytochrome C release and caspase activation (such as CASP9) and inducing mitochondrial permeability transition. May be involved in hypoxia-induced cell death of neuronal cells probably by promoting release of AIFM1 from mitochondria to cytoplasm and its translocation to the nucleus; however, the involvement of caspases has been reported conflictingly']"	"FAM162A"	""	"F6PVM6_MONDO"	"1b48ad22e090a49f381d6b6a795f3eaeacb3a5ba"	True	False	False	66	"Protein FAM162A"	3	"UP000002280"	"MLDAAKNRFRVRVSYLMIALTILGCVIMVIQGKQAVKRHETLTSLNLERKALLRKQEEEAIKSKTD"	"unreviewed"	"{'taxId': '13616', 'scientificName': 'Monodelphis domestica', 'fullName': 'Monodelphis domestica (Gray short-tailed opossum)'}"
