General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F4H8K1",
        "id": "F4H8K1_CELFA",
        "source_organism": {
            "taxId": "590998",
            "scientificName": "Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / CCUG 24087 / LMG 16345 / NBRC 15513 / NCIMB 8980 / NCTC 7547 / NRS-133)",
            "fullName": "Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / CCUG 24087 / LMG 16345 / NBRC 15513 / NCIMB 8980 / NCTC 7547 / NRS-133)"
        },
        "name": "Inactive dihydropteroate synthase 2",
        "description": [
            "Has very low affinity for the DHPS substrate 6-hydroxymethyl-7,8-dihydropterin-pyrophosphate, but can bind the inhibitor dapsone. Seems to lack dihydropteroate synthase activity, and does probably not function in folate metabolism"
        ],
        "length": 308,
        "sequence": "MSTAVPPAGAHLRLRGRVVGDGGPVVMAVVNRTPDSFYAAARHDDASADAAVDRAVEEGADLVDLGGVRAGRGPRVDVAEEIARVVPLVARVRARHPELLVSIDTWRAEVARAAAAEGVDLVNDTWAGHDPRLVEVAAEHGLGVVCSHTGGARPRTDPLRVEYPRSGPLEDPDDGLDGVLDDVVATVTAGAARAVALGVDPGSVLVDPTHDFGKNTWHSLHLVRRTAALVALGHPVLMALSRKDFVGESLDLPVDERLEGTLAATSVAAWLGARVFRVHDVAATRRTLDMVAVVRGDRPPARAVRGLA",
        "proteome": "UP000008460",
        "gene": "Celf_2887",
        "go_terms": [
            {
                "identifier": "GO:0042558",
                "name": "pteridine-containing compound metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009396",
                "name": "folic acid-containing compound biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004156",
                "name": "dihydropteroate synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "105f02382abc961b20a268efdde31f2846c9584c",
        "counters": {
            "domain_architectures": 33850,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 33850
        }
    }
}