"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F4H8K1"	"{'domain_architectures': 33850, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'ncbifam': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 33850}"	"['Has very low affinity for the DHPS substrate 6-hydroxymethyl-7,8-dihydropterin-pyrophosphate, but can bind the inhibitor dapsone. Seems to lack dihydropteroate synthase activity, and does probably not function in folate metabolism']"	"Celf_2887"	"[{'identifier': 'GO:0042558', 'name': 'pteridine-containing compound metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009396', 'name': 'folic acid-containing compound biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0004156', 'name': 'dihydropteroate synthase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"F4H8K1_CELFA"	"105f02382abc961b20a268efdde31f2846c9584c"	True	False	False	308	"Inactive dihydropteroate synthase 2"	3	"UP000008460"	"MSTAVPPAGAHLRLRGRVVGDGGPVVMAVVNRTPDSFYAAARHDDASADAAVDRAVEEGADLVDLGGVRAGRGPRVDVAEEIARVVPLVARVRARHPELLVSIDTWRAEVARAAAAEGVDLVNDTWAGHDPRLVEVAAEHGLGVVCSHTGGARPRTDPLRVEYPRSGPLEDPDDGLDGVLDDVVATVTAGAARAVALGVDPGSVLVDPTHDFGKNTWHSLHLVRRTAALVALGHPVLMALSRKDFVGESLDLPVDERLEGTLAATSVAAWLGARVFRVHDVAATRRTLDMVAVVRGDRPPARAVRGLA"	"unreviewed"	"{'taxId': '590998', 'scientificName': 'Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / CCUG 24087 / LMG 16345 / NBRC 15513 / NCIMB 8980 / NCTC 7547 / NRS-133)', 'fullName': 'Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / CCUG 24087 / LMG 16345 / NBRC 15513 / NCIMB 8980 / NCTC 7547 / NRS-133)'}"