GET /api/protein/UniProt/F4H2I6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F4H2I6",
"id": "F4H2I6_CELFA",
"source_organism": {
"taxId": "590998",
"scientificName": "Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / CCUG 24087 / LMG 16345 / NBRC 15513 / NCIMB 8980 / NCTC 7547 / NRS-133)",
"fullName": "Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / CCUG 24087 / LMG 16345 / NBRC 15513 / NCIMB 8980 / NCTC 7547 / NRS-133)"
},
"name": "Lactose phosphotransferase system repressor",
"description": [
"Repressor of the lactose catabolism operon. Galactose-6-phosphate is the inducer"
],
"length": 253,
"sequence": "MYAPERHQQILARARAEGRVDVTALADQLDVTPETIRRDLTALERHGLVRRVHGGAIPVERLGFEPGIADREGVLAGEKERIAKAALDELPDGGAVILDAGTTTVRLAELLPSDRELTVVTHALPVATVLAPRPGITLHLVGGTVRGRTLAAVGSWAVRALADIHADVAFVGTNGLSVEHGLTTPDLAEAAVKRALVRSARRTVVLADHTKLGRVDFAHVVPLADVDTVVTDTGAEPELVDEIEAAGTRVVRA",
"proteome": "UP000008460",
"gene": "Celf_1077",
"go_terms": [
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a6ebeee1898c227af3be886e364d08a3da52eb8d",
"counters": {
"domain_architectures": 65528,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"ssf": 2,
"pfam": 2,
"smart": 2,
"cathgene3d": 2,
"panther": 1,
"prints": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 65528
}
}
}