"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F4H2I6"	"{'domain_architectures': 65528, 'entries': 17, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'ssf': 2, 'pfam': 2, 'smart': 2, 'cathgene3d': 2, 'panther': 1, 'prints': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 65528}"	"['Repressor of the lactose catabolism operon. Galactose-6-phosphate is the inducer']"	"Celf_1077"	"[{'identifier': 'GO:0003700', 'name': 'DNA-binding transcription factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"F4H2I6_CELFA"	"a6ebeee1898c227af3be886e364d08a3da52eb8d"	True	False	False	253	"Lactose phosphotransferase system repressor"	4	"UP000008460"	"MYAPERHQQILARARAEGRVDVTALADQLDVTPETIRRDLTALERHGLVRRVHGGAIPVERLGFEPGIADREGVLAGEKERIAKAALDELPDGGAVILDAGTTTVRLAELLPSDRELTVVTHALPVATVLAPRPGITLHLVGGTVRGRTLAAVGSWAVRALADIHADVAFVGTNGLSVEHGLTTPDLAEAAVKRALVRSARRTVVLADHTKLGRVDFAHVVPLADVDTVVTDTGAEPELVDEIEAAGTRVVRA"	"unreviewed"	"{'taxId': '590998', 'scientificName': 'Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / CCUG 24087 / LMG 16345 / NBRC 15513 / NCIMB 8980 / NCTC 7547 / NRS-133)', 'fullName': 'Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / CCUG 24087 / LMG 16345 / NBRC 15513 / NCIMB 8980 / NCTC 7547 / NRS-133)'}"
