GET /api/protein/UniProt/F4BA37/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F4BA37",
        "id": "F4BA37_ACIHW",
        "source_organism": {
            "taxId": "933801",
            "scientificName": "Acidianus hospitalis (strain W1)",
            "fullName": "Acidianus hospitalis (strain W1)"
        },
        "name": "ATP phosphoribosyltransferase",
        "description": [
            "Catalyzes the condensation of ATP and 5-phosphoribose 1-diphosphate to form N'-(5'-phosphoribosyl)-ATP (PR-ATP). Has a crucial role in the pathway because the rate of histidine biosynthesis seems to be controlled primarily by regulation of HisG enzymatic activity"
        ],
        "length": 299,
        "sequence": "MRFWLKLWVRFLKVAIPNKGRLQQPTLQFLTQVGIKPLASDERALMIPTSWDGVQLVMMRTEDIPNLVEAGAAEIGITGHDYVTESKADVEELIKLDFGKAKIVLAVPQNWDVENVEDLRRKKNGIRIATKYYNIAKEYLDKVDIDAKIVKISGAAEVMPSLGAADAIIDVVSTGTTLKLHGLKPIDEILQTYAVVIGNKYWMKSEEAERVNLVLTMMKGVISARGRKMIFMNVDDSKLEDVISSLPAMLSPAISRLSKTNAWEVITVAEESQLPEVIAKAKAAGARDIVVVNIEKVVK",
        "proteome": "UP000008458",
        "gene": "hisG",
        "go_terms": [
            {
                "identifier": "GO:0000287",
                "name": "magnesium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003879",
                "name": "ATP phosphoribosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000105",
                "name": "L-histidine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2e67110073aee079eb78374ed3effa0dc4234492",
        "counters": {
            "domain_architectures": 14110,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "cdd": 1,
                "pfam": 2,
                "hamap": 1,
                "ncbifam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 14110
        }
    }
}