HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F4BA37",
"id": "F4BA37_ACIHW",
"source_organism": {
"taxId": "933801",
"scientificName": "Acidianus hospitalis (strain W1)",
"fullName": "Acidianus hospitalis (strain W1)"
},
"name": "ATP phosphoribosyltransferase",
"description": [
"Catalyzes the condensation of ATP and 5-phosphoribose 1-diphosphate to form N'-(5'-phosphoribosyl)-ATP (PR-ATP). Has a crucial role in the pathway because the rate of histidine biosynthesis seems to be controlled primarily by regulation of HisG enzymatic activity"
],
"length": 299,
"sequence": "MRFWLKLWVRFLKVAIPNKGRLQQPTLQFLTQVGIKPLASDERALMIPTSWDGVQLVMMRTEDIPNLVEAGAAEIGITGHDYVTESKADVEELIKLDFGKAKIVLAVPQNWDVENVEDLRRKKNGIRIATKYYNIAKEYLDKVDIDAKIVKISGAAEVMPSLGAADAIIDVVSTGTTLKLHGLKPIDEILQTYAVVIGNKYWMKSEEAERVNLVLTMMKGVISARGRKMIFMNVDDSKLEDVISSLPAMLSPAISRLSKTNAWEVITVAEESQLPEVIAKAKAAGARDIVVVNIEKVVK",
"proteome": "UP000008458",
"gene": "hisG",
"go_terms": [
{
"identifier": "GO:0000287",
"name": "magnesium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003879",
"name": "ATP phosphoribosyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000105",
"name": "L-histidine biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2e67110073aee079eb78374ed3effa0dc4234492",
"counters": {
"domain_architectures": 14110,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"cdd": 1,
"pfam": 2,
"hamap": 1,
"ncbifam": 2,
"panther": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 14110
}
}
}