General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F2Z2A4",
        "id": "F2Z2A4_HUMAN",
        "source_organism": {
            "taxId": "9606",
            "scientificName": "Homo sapiens",
            "fullName": "Homo sapiens (Human)"
        },
        "name": "Deoxynucleotidyltransferase terminal-interacting protein 1",
        "description": [
            "Increases DNTT terminal deoxynucleotidyltransferase activity (in vitro). Also acts as a transcriptional regulator, binding to the consensus sequence 5'-GNTGCATG-3' following an AT-tract. Associates with RAB20 promoter and positively regulates its transcription. Binds DNA and nucleosomes; may recruit HDAC1 complexes to nucleosomes or naked DNA"
        ],
        "length": 145,
        "sequence": "MIKHRQVQRRGRRSQMTTSFTDPAISMDLLRAVLQPSINEEIQTVFNKYMKFFQKAALNVRDNVGEEVDAEQLIQEACRSCLEQAKLLFSDGEKVIPRLTHELPGIKRGRQAEEECAHRGSPLPKKRKGRPPGHILSSDRAAAGM",
        "proteome": "UP000005640",
        "gene": "DNTTIP1",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4a9ed610cf91970e25483939e2b1197389746980",
        "counters": {
            "domain_architectures": 102,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 102
        }
    }
}