"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F2Z2A4"	"{'domain_architectures': 102, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 102}"	"[""Increases DNTT terminal deoxynucleotidyltransferase activity (in vitro). Also acts as a transcriptional regulator, binding to the consensus sequence 5'-GNTGCATG-3' following an AT-tract. Associates with RAB20 promoter and positively regulates its transcription. Binds DNA and nucleosomes; may recruit HDAC1 complexes to nucleosomes or naked DNA""]"	"DNTTIP1"	""	"F2Z2A4_HUMAN"	"4a9ed610cf91970e25483939e2b1197389746980"	True	False	True	145	"Deoxynucleotidyltransferase terminal-interacting protein 1"	1	"UP000005640"	"MIKHRQVQRRGRRSQMTTSFTDPAISMDLLRAVLQPSINEEIQTVFNKYMKFFQKAALNVRDNVGEEVDAEQLIQEACRSCLEQAKLLFSDGEKVIPRLTHELPGIKRGRQAEEECAHRGSPLPKKRKGRPPGHILSSDRAAAGM"	"unreviewed"	"{'taxId': '9606', 'scientificName': 'Homo sapiens', 'fullName': 'Homo sapiens (Human)'}"