GET /api/protein/UniProt/F0RD13/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F0RD13",
        "id": "F0RD13_CELLC",
        "source_organism": {
            "taxId": "867900",
            "scientificName": "Cellulophaga lytica (strain ATCC 23178 / DSM 7489 / JCM 8516 / NBRC 14961 / NCIMB 1423 / VKM B-1433 / Cy l20)",
            "fullName": "Cellulophaga lytica (strain ATCC 23178 / DSM 7489 / JCM 8516 / NBRC 14961 / NCIMB 1423 / VKM B-1433 / Cy l20)"
        },
        "name": "Putative tRNA (cytidine(34)-2'-O)-methyltransferase",
        "description": [
            "Could methylate the ribose at the nucleotide 34 wobble position in tRNA"
        ],
        "length": 151,
        "sequence": "MSFNIVLFEPEIPNNTGNIGRLSLASGSTLHLVKPFGFELNDKRVKRAGLDYWQHLDLKIYDSITHFFEVHSDKKFAFLSAKAEKNYYEIDYEDNMFFVFGKESVGLPASVVEKHKNSLYKIPLFSEHIRSLNLANAVSIVIYDAIKSKKL",
        "proteome": "UP000007487",
        "gene": "Celly_0868",
        "go_terms": [
            {
                "identifier": "GO:0008168",
                "name": "methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0001510",
                "name": "RNA methylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008173",
                "name": "RNA methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006396",
                "name": "RNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1f4922ed6291786582caadede6a092d9f64a556b",
        "counters": {
            "domain_architectures": 60928,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "pirsf": 1,
                "hamap": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 60928
        }
    }
}