"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F0RD13"	"{'domain_architectures': 60928, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'pirsf': 1, 'hamap': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 60928}"	"['Could methylate the ribose at the nucleotide 34 wobble position in tRNA']"	"Celly_0868"	"[{'identifier': 'GO:0008168', 'name': 'methyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0001510', 'name': 'RNA methylation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008173', 'name': 'RNA methyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006396', 'name': 'RNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"F0RD13_CELLC"	"1f4922ed6291786582caadede6a092d9f64a556b"	True	False	False	151	"Putative tRNA (cytidine(34)-2'-O)-methyltransferase"	3	"UP000007487"	"MSFNIVLFEPEIPNNTGNIGRLSLASGSTLHLVKPFGFELNDKRVKRAGLDYWQHLDLKIYDSITHFFEVHSDKKFAFLSAKAEKNYYEIDYEDNMFFVFGKESVGLPASVVEKHKNSLYKIPLFSEHIRSLNLANAVSIVIYDAIKSKKL"	"unreviewed"	"{'taxId': '867900', 'scientificName': 'Cellulophaga lytica (strain ATCC 23178 / DSM 7489 / JCM 8516 / NBRC 14961 / NCIMB 1423 / VKM B-1433 / Cy l20)', 'fullName': 'Cellulophaga lytica (strain ATCC 23178 / DSM 7489 / JCM 8516 / NBRC 14961 / NCIMB 1423 / VKM B-1433 / Cy l20)'}"
