GET /api/protein/UniProt/E9EMG5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E9EMG5",
        "id": "E9EMG5_METRA",
        "source_organism": {
            "taxId": "655844",
            "scientificName": "Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)",
            "fullName": "Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)"
        },
        "name": "Transcription elongation factor",
        "description": [
            "Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus"
        ],
        "length": 300,
        "sequence": "MDQRELESRVKALTKSVAANEPPENAIKLLESLKKDAKPTEEMLRATKAGVFVAKLRANPNKEIARSAAELVIKWKKLVEQEKASRAQRPKMGSPAAAPASSPVPQAGSATGAKKAFTGDPEKRSFTADGVELKRTSSGVRDRCIGLIYNGLAYRSTESPDDVIARAVAVEHAVFIEFKEDEGEGYKKKIRSLFANLKTKSNKDLGKRVMSGDISPEKFAKMTDEELKSEDQRKKEIELEKENMKRAQVPMAEKSISDSLECGRCKMKKVSYTQAQTRSADEPMTTFCECMNCGHRWKFS",
        "proteome": "UP000002498",
        "gene": "MAA_00672",
        "go_terms": [
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0006351",
                "name": "DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006368",
                "name": "transcription elongation by RNA polymerase II",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b4d6aa1a0f4c42d4d771098499feedb88ba6b77e",
        "counters": {
            "domain_architectures": 6289,
            "entries": 28,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "profile": 3,
                "smart": 3,
                "pfam": 3,
                "cdd": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6289
        }
    }
}