HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E9EMG5",
"id": "E9EMG5_METRA",
"source_organism": {
"taxId": "655844",
"scientificName": "Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)",
"fullName": "Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)"
},
"name": "Transcription elongation factor",
"description": [
"Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus"
],
"length": 300,
"sequence": "MDQRELESRVKALTKSVAANEPPENAIKLLESLKKDAKPTEEMLRATKAGVFVAKLRANPNKEIARSAAELVIKWKKLVEQEKASRAQRPKMGSPAAAPASSPVPQAGSATGAKKAFTGDPEKRSFTADGVELKRTSSGVRDRCIGLIYNGLAYRSTESPDDVIARAVAVEHAVFIEFKEDEGEGYKKKIRSLFANLKTKSNKDLGKRVMSGDISPEKFAKMTDEELKSEDQRKKEIELEKENMKRAQVPMAEKSISDSLECGRCKMKKVSYTQAQTRSADEPMTTFCECMNCGHRWKFS",
"proteome": "UP000002498",
"gene": "MAA_00672",
"go_terms": [
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0006351",
"name": "DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006368",
"name": "transcription elongation by RNA polymerase II",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b4d6aa1a0f4c42d4d771098499feedb88ba6b77e",
"counters": {
"domain_architectures": 6289,
"entries": 28,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 3,
"profile": 3,
"smart": 3,
"pfam": 3,
"cdd": 1,
"pirsf": 1,
"ncbifam": 1,
"panther": 1,
"prosite": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6289
}
}
}