"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E9EMG5"	"{'domain_architectures': 6289, 'entries': 28, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 3, 'ssf': 3, 'profile': 3, 'smart': 3, 'pfam': 3, 'cdd': 1, 'pirsf': 1, 'ncbifam': 1, 'panther': 1, 'prosite': 1, 'interpro': 8}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 6289}"	"[""Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus""]"	"MAA_00672"	"[{'identifier': 'GO:0005634', 'name': 'nucleus', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0006351', 'name': 'DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003676', 'name': 'nucleic acid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006368', 'name': 'transcription elongation by RNA polymerase II', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"E9EMG5_METRA"	"b4d6aa1a0f4c42d4d771098499feedb88ba6b77e"	True	False	False	300	"Transcription elongation factor"	3	"UP000002498"	"MDQRELESRVKALTKSVAANEPPENAIKLLESLKKDAKPTEEMLRATKAGVFVAKLRANPNKEIARSAAELVIKWKKLVEQEKASRAQRPKMGSPAAAPASSPVPQAGSATGAKKAFTGDPEKRSFTADGVELKRTSSGVRDRCIGLIYNGLAYRSTESPDDVIARAVAVEHAVFIEFKEDEGEGYKKKIRSLFANLKTKSNKDLGKRVMSGDISPEKFAKMTDEELKSEDQRKKEIELEKENMKRAQVPMAEKSISDSLECGRCKMKKVSYTQAQTRSADEPMTTFCECMNCGHRWKFS"	"unreviewed"	"{'taxId': '655844', 'scientificName': 'Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)', 'fullName': 'Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)'}"
