GET /api/protein/UniProt/E9EDG6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E9EDG6",
        "id": "E9EDG6_METAQ",
        "source_organism": {
            "taxId": "655827",
            "scientificName": "Metarhizium acridum (strain CQMa 102)",
            "fullName": "Metarhizium acridum (strain CQMa 102)"
        },
        "name": "V-type proton ATPase subunit F",
        "description": [
            "Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments"
        ],
        "length": 136,
        "sequence": "MANQADYKNREFLAVIGDEDSVTGLLLAGIGHVTAGADAQKNFLVVDSKTDTAAIESAFDRFTQDRNDIGIVLINQHIADRIRHRIDTYTAAFPTVLEIPSKDHPYDPEKDSVLRRPNCVGHDGTEHVALANRQLA",
        "proteome": "UP000002499",
        "gene": "MAC_07914",
        "go_terms": [
            {
                "identifier": "GO:0034220",
                "name": "monoatomic ion transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0046961",
                "name": "proton-transporting ATPase activity, rotational mechanism",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:1902600",
                "name": "proton transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0033180",
                "name": "proton-transporting V-type ATPase, V1 domain",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "06d4784b2e6318c50671b6dc0edecc495f96d68c",
        "counters": {
            "domain_architectures": 7515,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7515
        }
    }
}