"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E9EDG6"	"{'domain_architectures': 7515, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'pirsf': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 7515}"	"['Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments']"	"MAC_07914"	"[{'identifier': 'GO:0034220', 'name': 'monoatomic ion transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0046961', 'name': 'proton-transporting ATPase activity, rotational mechanism', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:1902600', 'name': 'proton transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0033180', 'name': 'proton-transporting V-type ATPase, V1 domain', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"E9EDG6_METAQ"	"06d4784b2e6318c50671b6dc0edecc495f96d68c"	True	False	False	136	"V-type proton ATPase subunit F"	3	"UP000002499"	"MANQADYKNREFLAVIGDEDSVTGLLLAGIGHVTAGADAQKNFLVVDSKTDTAAIESAFDRFTQDRNDIGIVLINQHIADRIRHRIDTYTAAFPTVLEIPSKDHPYDPEKDSVLRRPNCVGHDGTEHVALANRQLA"	"unreviewed"	"{'taxId': '655827', 'scientificName': 'Metarhizium acridum (strain CQMa 102)', 'fullName': 'Metarhizium acridum (strain CQMa 102)'}"
