GET /api/protein/UniProt/E8N4K3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E8N4K3",
        "id": "E8N4K3_ANATU",
        "source_organism": {
            "taxId": "926569",
            "scientificName": "Anaerolinea thermophila (strain DSM 14523 / JCM 11388 / NBRC 100420 / UNI-1)",
            "fullName": "Anaerolinea thermophila (strain DSM 14523 / JCM 11388 / NBRC 100420 / UNI-1)"
        },
        "name": "threonine ammonia-lyase",
        "description": [
            "Catalyzes the anaerobic formation of alpha-ketobutyrate and ammonia from threonine in a two-step reaction. The first step involved a dehydration of threonine and a production of enamine intermediates (aminocrotonate), which tautomerizes to its imine form (iminobutyrate). Both intermediates are unstable and short-lived. The second step is the nonenzymatic hydrolysis of the enamine/imine intermediates to form 2-ketobutyrate and free ammonia. In the low water environment of the cell, the second step is accelerated by RidA"
        ],
        "length": 313,
        "sequence": "MIFPWEWLEQAYQRLQDKVIQTPLTQDEVAAITLKWENQQITGSFKVRGALNRALTLQPWEIEKGLVCASAGNHGQGVAYAAKLLGASCIVFTYEGASAHKIEQMRQLGAKVHIVPGHYADAERAGLEYARSHQATWISPYNDPQVIAGQATVGLELIEQWKAEIPASVVVPVGGGGLAAGIALAMQRLPHPPKVIGVQSEASAYFHALFHQNNKKEVVEWESLADGLAGDVEDNSITIPLVKTHLFDLRLVSEKEIAEAIRFAWQRYGERIEGSAAVTLAAVLSRKVDELPATLIISGGNIDPQIFENILHS",
        "proteome": "UP000008922",
        "gene": "ANT_13350",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8bc361cd7c1d6142f8798dedc919bc5496ed8194",
        "counters": {
            "domain_architectures": 181949,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 181949
        }
    }
}