GET /api/protein/UniProt/E8N4K3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E8N4K3",
"id": "E8N4K3_ANATU",
"source_organism": {
"taxId": "926569",
"scientificName": "Anaerolinea thermophila (strain DSM 14523 / JCM 11388 / NBRC 100420 / UNI-1)",
"fullName": "Anaerolinea thermophila (strain DSM 14523 / JCM 11388 / NBRC 100420 / UNI-1)"
},
"name": "threonine ammonia-lyase",
"description": [
"Catalyzes the anaerobic formation of alpha-ketobutyrate and ammonia from threonine in a two-step reaction. The first step involved a dehydration of threonine and a production of enamine intermediates (aminocrotonate), which tautomerizes to its imine form (iminobutyrate). Both intermediates are unstable and short-lived. The second step is the nonenzymatic hydrolysis of the enamine/imine intermediates to form 2-ketobutyrate and free ammonia. In the low water environment of the cell, the second step is accelerated by RidA"
],
"length": 313,
"sequence": "MIFPWEWLEQAYQRLQDKVIQTPLTQDEVAAITLKWENQQITGSFKVRGALNRALTLQPWEIEKGLVCASAGNHGQGVAYAAKLLGASCIVFTYEGASAHKIEQMRQLGAKVHIVPGHYADAERAGLEYARSHQATWISPYNDPQVIAGQATVGLELIEQWKAEIPASVVVPVGGGGLAAGIALAMQRLPHPPKVIGVQSEASAYFHALFHQNNKKEVVEWESLADGLAGDVEDNSITIPLVKTHLFDLRLVSEKEIAEAIRFAWQRYGERIEGSAAVTLAAVLSRKVDELPATLIISGGNIDPQIFENILHS",
"proteome": "UP000008922",
"gene": "ANT_13350",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8bc361cd7c1d6142f8798dedc919bc5496ed8194",
"counters": {
"domain_architectures": 181949,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 181949
}
}
}