"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E8N4K3"	"{'domain_architectures': 181949, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 181949}"	"['Catalyzes the anaerobic formation of alpha-ketobutyrate and ammonia from threonine in a two-step reaction. The first step involved a dehydration of threonine and a production of enamine intermediates (aminocrotonate), which tautomerizes to its imine form (iminobutyrate). Both intermediates are unstable and short-lived. The second step is the nonenzymatic hydrolysis of the enamine/imine intermediates to form 2-ketobutyrate and free ammonia. In the low water environment of the cell, the second step is accelerated by RidA']"	"ANT_13350"	""	"E8N4K3_ANATU"	"8bc361cd7c1d6142f8798dedc919bc5496ed8194"	True	False	False	313	"threonine ammonia-lyase"	3	"UP000008922"	"MIFPWEWLEQAYQRLQDKVIQTPLTQDEVAAITLKWENQQITGSFKVRGALNRALTLQPWEIEKGLVCASAGNHGQGVAYAAKLLGASCIVFTYEGASAHKIEQMRQLGAKVHIVPGHYADAERAGLEYARSHQATWISPYNDPQVIAGQATVGLELIEQWKAEIPASVVVPVGGGGLAAGIALAMQRLPHPPKVIGVQSEASAYFHALFHQNNKKEVVEWESLADGLAGDVEDNSITIPLVKTHLFDLRLVSEKEIAEAIRFAWQRYGERIEGSAAVTLAAVLSRKVDELPATLIISGGNIDPQIFENILHS"	"unreviewed"	"{'taxId': '926569', 'scientificName': 'Anaerolinea thermophila (strain DSM 14523 / JCM 11388 / NBRC 100420 / UNI-1)', 'fullName': 'Anaerolinea thermophila (strain DSM 14523 / JCM 11388 / NBRC 100420 / UNI-1)'}"