HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E7A9X7",
"id": "E7A9X7_HELFC",
"source_organism": {
"taxId": "936155",
"scientificName": "Helicobacter felis (strain ATCC 49179 / CCUG 28539 / NCTC 12436 / CS1)",
"fullName": "Helicobacter felis (strain ATCC 49179 / CCUG 28539 / NCTC 12436 / CS1)"
},
"name": "ATP-dependent dethiobiotin synthetase BioD",
"description": [
"Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring"
],
"length": 219,
"sequence": "MYAPIFVSATNTGVGKTTLSLEIARLCKARGIKTLLAKPIETGVNSEEESDAELFLQENLQTEAHLSLEDISFCRYVLGASPFVATRFEPHIVIDFKEIKRKLDMLQERCNLLIVEGVGGLLAPLDAKNKIIDLCLFLKARLLIVNTDHLGMLNNLLLNQEYLNAHKISHHMLINVRDRRAYTQICKPYIEHLNTTLKTPILEFPEQSARLLDAILVPC",
"proteome": "UP000007934",
"gene": "bioD",
"go_terms": [
{
"identifier": "GO:0000287",
"name": "magnesium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004141",
"name": "dethiobiotin synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009102",
"name": "biotin biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "762f05ff64f9560099eda419734dc65898a81f59",
"counters": {
"domain_architectures": 17905,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"hamap": 1,
"pirsf": 1,
"ncbifam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17905
}
}
}