"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E7A9X7"	"{'domain_architectures': 17905, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'hamap': 1, 'pirsf': 1, 'ncbifam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 17905}"	"['Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring']"	"bioD"	"[{'identifier': 'GO:0000287', 'name': 'magnesium ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0004141', 'name': 'dethiobiotin synthase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005524', 'name': 'ATP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009102', 'name': 'biotin biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"E7A9X7_HELFC"	"762f05ff64f9560099eda419734dc65898a81f59"	True	False	False	219	"ATP-dependent dethiobiotin synthetase BioD"	3	"UP000007934"	"MYAPIFVSATNTGVGKTTLSLEIARLCKARGIKTLLAKPIETGVNSEEESDAELFLQENLQTEAHLSLEDISFCRYVLGASPFVATRFEPHIVIDFKEIKRKLDMLQERCNLLIVEGVGGLLAPLDAKNKIIDLCLFLKARLLIVNTDHLGMLNNLLLNQEYLNAHKISHHMLINVRDRRAYTQICKPYIEHLNTTLKTPILEFPEQSARLLDAILVPC"	"unreviewed"	"{'taxId': '936155', 'scientificName': 'Helicobacter felis (strain ATCC 49179 / CCUG 28539 / NCTC 12436 / CS1)', 'fullName': 'Helicobacter felis (strain ATCC 49179 / CCUG 28539 / NCTC 12436 / CS1)'}"