General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E4TW78",
        "id": "E4TW78_SULKY",
        "source_organism": {
            "taxId": "709032",
            "scientificName": "Sulfuricurvum kujiense (strain ATCC BAA-921 / DSM 16994 / JCM 11577 / YK-1)",
            "fullName": "Sulfuricurvum kujiense (strain ATCC BAA-921 / DSM 16994 / JCM 11577 / YK-1)"
        },
        "name": "Adenosylcobinamide kinase",
        "description": [
            "Catalyzes ATP-dependent phosphorylation of adenosylcobinamide and addition of GMP to adenosylcobinamide phosphate"
        ],
        "length": 163,
        "sequence": "MKILYFGGQKSGKSSLAEAKTLAIATDKPYYLATYDHTFGDEEMGARIDKHRISRGEEFITLEESRDLSRVIEPHHTYLVDCISMWILNRLDENEEVLVAEIEALGAIDANIVFVLNDVTSGVIPSDPISRRYVDLSGIIGQRLARLCDEVVEVKLGLERRLK",
        "proteome": "UP000008721",
        "gene": "Sulku_0026",
        "go_terms": [
            {
                "identifier": "GO:0000166",
                "name": "nucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043752",
                "name": "adenosylcobinamide kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009236",
                "name": "cobalamin biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3eba2445165e84c110abfdc2624b2a06f3a969f7",
        "counters": {
            "domain_architectures": 14880,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "ssf": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 14880
        }
    }
}