"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E4TW78"	"{'domain_architectures': 14880, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'ssf': 1, 'pirsf': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 14880}"	"['Catalyzes ATP-dependent phosphorylation of adenosylcobinamide and addition of GMP to adenosylcobinamide phosphate']"	"Sulku_0026"	"[{'identifier': 'GO:0000166', 'name': 'nucleotide binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0043752', 'name': 'adenosylcobinamide kinase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009236', 'name': 'cobalamin biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"E4TW78_SULKY"	"3eba2445165e84c110abfdc2624b2a06f3a969f7"	True	False	False	163	"Adenosylcobinamide kinase"	3	"UP000008721"	"MKILYFGGQKSGKSSLAEAKTLAIATDKPYYLATYDHTFGDEEMGARIDKHRISRGEEFITLEESRDLSRVIEPHHTYLVDCISMWILNRLDENEEVLVAEIEALGAIDANIVFVLNDVTSGVIPSDPISRRYVDLSGIIGQRLARLCDEVVEVKLGLERRLK"	"unreviewed"	"{'taxId': '709032', 'scientificName': 'Sulfuricurvum kujiense (strain ATCC BAA-921 / DSM 16994 / JCM 11577 / YK-1)', 'fullName': 'Sulfuricurvum kujiense (strain ATCC BAA-921 / DSM 16994 / JCM 11577 / YK-1)'}"
