HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E3QPI8",
"id": "E3QPI8_COLGM",
"source_organism": {
"taxId": "645133",
"scientificName": "Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212)",
"fullName": "Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) (Maize anthracnose fungus)"
},
"name": "NCT transcriptional regulatory complex subunit B",
"description": [
"Part of the NCT transcriptional regulatory complex that acts as a key regulator of ergosterol biosynthesis and the azole exporter cdr1B. The NCT complex binds the promoters of genes linked to azole susceptibility, and especially represses the expression of cdr1B transporter"
],
"length": 128,
"sequence": "MLIAITATVQKIVTEILPPSAGVAFSKEARDLLIECCVEFITLISSEANEISEKEAKKTIACDHITKALEQLGFADYVPAVLEAAAEHKEVQKGREKKANKFANSQIPLEELERMQREAFEDAANRHA",
"proteome": "UP000008782",
"gene": "GLRG_07920",
"go_terms": [
{
"identifier": "GO:0046982",
"name": "protein heterodimerization activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0140223",
"name": "general transcription initiation factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000122",
"name": "negative regulation of transcription by RNA polymerase II",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0017054",
"name": "negative cofactor 2 complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6df952aa255ac470bf7b0d945c8fb5d61ae9c767",
"counters": {
"domain_architectures": 32824,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 32824
}
}
}