GET /api/protein/UniProt/E3QPI8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E3QPI8",
        "id": "E3QPI8_COLGM",
        "source_organism": {
            "taxId": "645133",
            "scientificName": "Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212)",
            "fullName": "Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) (Maize anthracnose fungus)"
        },
        "name": "NCT transcriptional regulatory complex subunit B",
        "description": [
            "Part of the NCT transcriptional regulatory complex that acts as a key regulator of ergosterol biosynthesis and the azole exporter cdr1B. The NCT complex binds the promoters of genes linked to azole susceptibility, and especially represses the expression of cdr1B transporter"
        ],
        "length": 128,
        "sequence": "MLIAITATVQKIVTEILPPSAGVAFSKEARDLLIECCVEFITLISSEANEISEKEAKKTIACDHITKALEQLGFADYVPAVLEAAAEHKEVQKGREKKANKFANSQIPLEELERMQREAFEDAANRHA",
        "proteome": "UP000008782",
        "gene": "GLRG_07920",
        "go_terms": [
            {
                "identifier": "GO:0046982",
                "name": "protein heterodimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0140223",
                "name": "general transcription initiation factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000122",
                "name": "negative regulation of transcription by RNA polymerase II",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0017054",
                "name": "negative cofactor 2 complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6df952aa255ac470bf7b0d945c8fb5d61ae9c767",
        "counters": {
            "domain_architectures": 32824,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32824
        }
    }
}