"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E3QPI8"	"{'domain_architectures': 32824, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'ssf': 1, 'cdd': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 32824}"	"['Part of the NCT transcriptional regulatory complex that acts as a key regulator of ergosterol biosynthesis and the azole exporter cdr1B. The NCT complex binds the promoters of genes linked to azole susceptibility, and especially represses the expression of cdr1B transporter']"	"GLRG_07920"	"[{'identifier': 'GO:0046982', 'name': 'protein heterodimerization activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0140223', 'name': 'general transcription initiation factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000122', 'name': 'negative regulation of transcription by RNA polymerase II', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0017054', 'name': 'negative cofactor 2 complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"E3QPI8_COLGM"	"6df952aa255ac470bf7b0d945c8fb5d61ae9c767"	True	False	False	128	"NCT transcriptional regulatory complex subunit B"	4	"UP000008782"	"MLIAITATVQKIVTEILPPSAGVAFSKEARDLLIECCVEFITLISSEANEISEKEAKKTIACDHITKALEQLGFADYVPAVLEAAAEHKEVQKGREKKANKFANSQIPLEELERMQREAFEDAANRHA"	"unreviewed"	"{'taxId': '645133', 'scientificName': 'Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212)', 'fullName': 'Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) (Maize anthracnose fungus)'}"