GET /api/protein/UniProt/E2X8B7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E2X8B7",
        "id": "E2X8B7_SHIDY",
        "source_organism": {
            "taxId": "754093",
            "scientificName": "Shigella dysenteriae 1617",
            "fullName": "Shigella dysenteriae 1617"
        },
        "name": "Bacterioferritin",
        "description": [
            "Iron-storage protein, whose ferroxidase center binds Fe(2+), oxidizes it using dioxygen to Fe(3+), and participates in the subsequent Fe(3+) oxide mineral core formation within the central cavity of the BFR protein shell"
        ],
        "length": 158,
        "sequence": "MKGDVKIINYLNKLLGNELVAINQYFLHARMFKNWGLMRLNDVEYHESIDEMKHADKYIERILFLEGVPNLQDLGKLGIGEDVEEMLQSDLRLELEGAKDLREAIAYADSVHDYVSRDMMIEILADEEGHIDWLETELDLIGKIGLQNYLQSQIKVKD",
        "proteome": null,
        "gene": "Asd1617_04618",
        "go_terms": [
            {
                "identifier": "GO:0008199",
                "name": "ferric iron binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006826",
                "name": "iron ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006879",
                "name": "intracellular iron ion homeostasis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cec8b804a2b695828936e90d7cf5ad612fb951b2",
        "counters": {
            "domain_architectures": 62699,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 1,
                "pirsf": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 62699
        }
    }
}