"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E2X8B7"	"{'domain_architectures': 62699, 'entries': 15, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'ncbifam': 1, 'pirsf': 1, 'panther': 1, 'prosite': 1, 'prints': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 62699}"	"['Iron-storage protein, whose ferroxidase center binds Fe(2+), oxidizes it using dioxygen to Fe(3+), and participates in the subsequent Fe(3+) oxide mineral core formation within the central cavity of the BFR protein shell']"	"Asd1617_04618"	"[{'identifier': 'GO:0008199', 'name': 'ferric iron binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006826', 'name': 'iron ion transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006879', 'name': 'intracellular iron ion homeostasis', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"E2X8B7_SHIDY"	"cec8b804a2b695828936e90d7cf5ad612fb951b2"	True	False	False	158	"Bacterioferritin"	3	""	"MKGDVKIINYLNKLLGNELVAINQYFLHARMFKNWGLMRLNDVEYHESIDEMKHADKYIERILFLEGVPNLQDLGKLGIGEDVEEMLQSDLRLELEGAKDLREAIAYADSVHDYVSRDMMIEILADEEGHIDWLETELDLIGKIGLQNYLQSQIKVKD"	"unreviewed"	"{'taxId': '754093', 'scientificName': 'Shigella dysenteriae 1617', 'fullName': 'Shigella dysenteriae 1617'}"