GET /api/protein/UniProt/E1CIQ4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E1CIQ4",
"id": "E1CIQ4_9ADEN",
"source_organism": {
"taxId": "46931",
"scientificName": "Human adenovirus 29",
"fullName": "Human adenovirus 29"
},
"name": "34 kDa protein",
"description": [
"Plays a major role to prevent cellular inhibition of viral genome replication by nuclear bodies. Assembles an SCF-like E3 ubiquitin ligase complex based on the cellular proteins ELOB, ELOC, CUL5 and RBX1, in cooperation with viral E1B-55K. This viral RING-type ligase ubiquitinates cellular substrates prior to proteasomal degradation: p53/TP53, LIG4, MRE11-RAD50-NBS1 (MRN) complex, ITGA3, DAXX and BLM"
],
"length": 292,
"sequence": "MQTEDQSSLLRHHPYRRARLPRSDEETRASLTEQHPLLPDCDHAEYHNVSSVRGLPCAAGFTLLQEFPVPWDMILTPEEIKILKRCMSVCLCPATLDLVRAQMVSGYERWILHCHCSSPGSLQCRAGGTLLAVWFRRVIYGCMFNQRFPWYRQIVNRDMPKEIMYMGSVFMRGRHLIYCRIWYDGHVGSIIPNMSFGWSTLNYGLLNNMVIMCCTYCENMAEIRMRCCARRTRRLMLKAVGIIVRETCDPDPICSSRTEPRRQRLLRALMERHRPILFSEYESVRSSRSTRL",
"proteome": null,
"gene": "E4",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "74b2836dadd9d75a8335e8fe225f132fd14098ab",
"counters": {
"domain_architectures": 329,
"entries": 2,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 329
}
}
}