GET /api/protein/UniProt/E1CIQ4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E1CIQ4",
        "id": "E1CIQ4_9ADEN",
        "source_organism": {
            "taxId": "46931",
            "scientificName": "Human adenovirus 29",
            "fullName": "Human adenovirus 29"
        },
        "name": "34 kDa protein",
        "description": [
            "Plays a major role to prevent cellular inhibition of viral genome replication by nuclear bodies. Assembles an SCF-like E3 ubiquitin ligase complex based on the cellular proteins ELOB, ELOC, CUL5 and RBX1, in cooperation with viral E1B-55K. This viral RING-type ligase ubiquitinates cellular substrates prior to proteasomal degradation: p53/TP53, LIG4, MRE11-RAD50-NBS1 (MRN) complex, ITGA3, DAXX and BLM"
        ],
        "length": 292,
        "sequence": "MQTEDQSSLLRHHPYRRARLPRSDEETRASLTEQHPLLPDCDHAEYHNVSSVRGLPCAAGFTLLQEFPVPWDMILTPEEIKILKRCMSVCLCPATLDLVRAQMVSGYERWILHCHCSSPGSLQCRAGGTLLAVWFRRVIYGCMFNQRFPWYRQIVNRDMPKEIMYMGSVFMRGRHLIYCRIWYDGHVGSIIPNMSFGWSTLNYGLLNNMVIMCCTYCENMAEIRMRCCARRTRRLMLKAVGIIVRETCDPDPICSSRTEPRRQRLLRALMERHRPILFSEYESVRSSRSTRL",
        "proteome": null,
        "gene": "E4",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "74b2836dadd9d75a8335e8fe225f132fd14098ab",
        "counters": {
            "domain_architectures": 329,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 329
        }
    }
}