"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E1CIQ4"	"{'domain_architectures': 329, 'entries': 2, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 329}"	"['Plays a major role to prevent cellular inhibition of viral genome replication by nuclear bodies. Assembles an SCF-like E3 ubiquitin ligase complex based on the cellular proteins ELOB, ELOC, CUL5 and RBX1, in cooperation with viral E1B-55K. This viral RING-type ligase ubiquitinates cellular substrates prior to proteasomal degradation: p53/TP53, LIG4, MRE11-RAD50-NBS1 (MRN) complex, ITGA3, DAXX and BLM']"	"E4"	""	"E1CIQ4_9ADEN"	"74b2836dadd9d75a8335e8fe225f132fd14098ab"	False	False	False	292	"34 kDa protein"	3	""	"MQTEDQSSLLRHHPYRRARLPRSDEETRASLTEQHPLLPDCDHAEYHNVSSVRGLPCAAGFTLLQEFPVPWDMILTPEEIKILKRCMSVCLCPATLDLVRAQMVSGYERWILHCHCSSPGSLQCRAGGTLLAVWFRRVIYGCMFNQRFPWYRQIVNRDMPKEIMYMGSVFMRGRHLIYCRIWYDGHVGSIIPNMSFGWSTLNYGLLNNMVIMCCTYCENMAEIRMRCCARRTRRLMLKAVGIIVRETCDPDPICSSRTEPRRQRLLRALMERHRPILFSEYESVRSSRSTRL"	"unreviewed"	"{'taxId': '46931', 'scientificName': 'Human adenovirus 29', 'fullName': 'Human adenovirus 29'}"