GET /api/protein/UniProt/E1BSW6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E1BSW6",
        "id": "E1BSW6_CHICK",
        "source_organism": {
            "taxId": "9031",
            "scientificName": "Gallus gallus",
            "fullName": "Gallus gallus (Chicken)"
        },
        "name": "Pleckstrin homology domain-containing family F member 1",
        "description": [
            "May induce apoptosis through the lysosomal-mitochondrial pathway. Translocates to the lysosome initiating the permeabilization of lysosomal membrane (LMP) and resulting in the release of CTSD and CTSL to the cytoplasm. Triggers the caspase-independent apoptosis by altering mitochondrial membrane permeabilization (MMP) resulting in the release of PDCD8"
        ],
        "length": 273,
        "sequence": "MVDHLANTEINSQRIAAVENCFGASGQPLAVPGRVLLGEGILTKECRKKPKPRIFFLFNDILVYGSIVINKRKYNSQHIIPLEDVTLETLPDTLQMKNRWMIKTSKKSFVVSAASLTERKEWISHLEECIRHLLTKTGRQPSTEHAAPWIPDKATDICMRCTQTKFSTLTRRHHCRKCGFVVCGDCSRQRFLMPRLSPKPLRVCNLCYRQLLAEQKKEEEADCQQPEQYRSAIPGYEPSSGDDSDKSDDYKVDQWPADTEFYTSEVSWSSFHS",
        "proteome": "UP000000539",
        "gene": "PLEKHF1",
        "go_terms": [
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "934138eaaecada7d8609be99db9164767204da69",
        "counters": {
            "domain_architectures": 2160,
            "entries": 22,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 2,
                "ssf": 2,
                "cathgene3d": 2,
                "profile": 2,
                "smart": 2,
                "pfam": 2,
                "panther": 1,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2160
        }
    }
}