General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E0NFA1",
        "id": "E0NFA1_PEDAC",
        "source_organism": {
            "taxId": "862514",
            "scientificName": "Pediococcus acidilactici DSM 20284",
            "fullName": "Pediococcus acidilactici DSM 20284"
        },
        "name": "Xanthine phosphoribosyltransferase",
        "description": [
            "Converts the preformed base xanthine, a product of nucleic acid breakdown, to xanthosine 5'-monophosphate (XMP), so it can be reused for RNA or DNA synthesis"
        ],
        "length": 190,
        "sequence": "MKLLEDKIRSEGIVLPHNVLKVDGFLNHQVDPQLMFEIGKEFARLFKDQKVTKILTVESSGIAPAVMTGLAMDVPVIFARKHKSLTLKDDLYTASVYSYTKQTSNQISISKRFIDSNDRVLIIDDFLANGQAVSGLFDIADAAKIDVVGVGIVIEKTFQKGSQIIKDRNVQLESLAKIKALTDDGQVEFE",
        "proteome": "UP000004470",
        "gene": "xpt",
        "go_terms": [
            {
                "identifier": "GO:0016763",
                "name": "pentosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043101",
                "name": "purine-containing compound salvage",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0046110",
                "name": "xanthine metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}