"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E0NFA1"	"{'domain_architectures': 0, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'ncbifam': 2, 'hamap': 1, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1}"	"[""Converts the preformed base xanthine, a product of nucleic acid breakdown, to xanthosine 5'-monophosphate (XMP), so it can be reused for RNA or DNA synthesis""]"	"xpt"	"[{'identifier': 'GO:0016763', 'name': 'pentosyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0043101', 'name': 'purine-containing compound salvage', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0046110', 'name': 'xanthine metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"E0NFA1_PEDAC"	""	True	False	False	190	"Xanthine phosphoribosyltransferase"	3	"UP000004470"	"MKLLEDKIRSEGIVLPHNVLKVDGFLNHQVDPQLMFEIGKEFARLFKDQKVTKILTVESSGIAPAVMTGLAMDVPVIFARKHKSLTLKDDLYTASVYSYTKQTSNQISISKRFIDSNDRVLIIDDFLANGQAVSGLFDIADAAKIDVVGVGIVIEKTFQKGSQIIKDRNVQLESLAKIKALTDDGQVEFE"	"unreviewed"	"{'taxId': '862514', 'scientificName': 'Pediococcus acidilactici DSM 20284', 'fullName': 'Pediococcus acidilactici DSM 20284'}"