GET /api/protein/UniProt/D9RZV6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D9RZV6",
        "id": "D9RZV6_THEOJ",
        "source_organism": {
            "taxId": "555079",
            "scientificName": "Thermosediminibacter oceani (strain ATCC BAA-1034 / DSM 16646 / JW/IW-1228P)",
            "fullName": "Thermosediminibacter oceani (strain ATCC BAA-1034 / DSM 16646 / JW/IW-1228P)"
        },
        "name": "Cell shape-determining protein MreB",
        "description": [
            "Forms membrane-associated dynamic filaments that are essential for cell shape determination. Acts by regulating cell wall synthesis and cell elongation, and thus cell shape. A feedback loop between cell geometry and MreB localization may maintain elongated cell shape by targeting cell wall growth to regions of negative cell wall curvature"
        ],
        "length": 332,
        "sequence": "MDIGIDLGTASILVYVRGKGIVLQEPSVVALDKDTGEVLAVGEQARKMIGRTPGNIVAIRPLRAGVIADYTVTELMLKHFLKKVIQRKLFRPRVMVCVPAVITEVEKRAVIEAATAAGARQTFLIEEPIAAAIGAGLDISKPVGSMVVDIGGGTTDIAVLSLGGIVCGTSIRVAGDMFDEAIVKYVKKEFNLAIGERTAEEVKISLATVFPDADSSKSLEIRGRSLISGLPQTVTITARQTCEALQEPVERIIEAIFSVLEKTPPELAADISERGIVMTGGGSLLNGLDKLIAQRTNMPVYVAEDAVSCVALGAGKALECLDMLGPNAVYKK",
        "proteome": "UP000000272",
        "gene": "mreB",
        "go_terms": [
            {
                "identifier": "GO:0000902",
                "name": "cell morphogenesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f1ce741a32f1c95a7e3198eb4e4c5aa1ba4f93f0",
        "counters": {
            "domain_architectures": 28478,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "hamap": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 2,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 28478
        }
    }
}