GET /api/protein/UniProt/D9RZV6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D9RZV6",
"id": "D9RZV6_THEOJ",
"source_organism": {
"taxId": "555079",
"scientificName": "Thermosediminibacter oceani (strain ATCC BAA-1034 / DSM 16646 / JW/IW-1228P)",
"fullName": "Thermosediminibacter oceani (strain ATCC BAA-1034 / DSM 16646 / JW/IW-1228P)"
},
"name": "Cell shape-determining protein MreB",
"description": [
"Forms membrane-associated dynamic filaments that are essential for cell shape determination. Acts by regulating cell wall synthesis and cell elongation, and thus cell shape. A feedback loop between cell geometry and MreB localization may maintain elongated cell shape by targeting cell wall growth to regions of negative cell wall curvature"
],
"length": 332,
"sequence": "MDIGIDLGTASILVYVRGKGIVLQEPSVVALDKDTGEVLAVGEQARKMIGRTPGNIVAIRPLRAGVIADYTVTELMLKHFLKKVIQRKLFRPRVMVCVPAVITEVEKRAVIEAATAAGARQTFLIEEPIAAAIGAGLDISKPVGSMVVDIGGGTTDIAVLSLGGIVCGTSIRVAGDMFDEAIVKYVKKEFNLAIGERTAEEVKISLATVFPDADSSKSLEIRGRSLISGLPQTVTITARQTCEALQEPVERIIEAIFSVLEKTPPELAADISERGIVMTGGGSLLNGLDKLIAQRTNMPVYVAEDAVSCVALGAGKALECLDMLGPNAVYKK",
"proteome": "UP000000272",
"gene": "mreB",
"go_terms": [
{
"identifier": "GO:0000902",
"name": "cell morphogenesis",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f1ce741a32f1c95a7e3198eb4e4c5aa1ba4f93f0",
"counters": {
"domain_architectures": 28478,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"hamap": 1,
"pfam": 1,
"panther": 1,
"ncbifam": 2,
"prints": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 28478
}
}
}