"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D9RZV6"	"{'domain_architectures': 28478, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'hamap': 1, 'pfam': 1, 'panther': 1, 'ncbifam': 2, 'prints': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 28478}"	"['Forms membrane-associated dynamic filaments that are essential for cell shape determination. Acts by regulating cell wall synthesis and cell elongation, and thus cell shape. A feedback loop between cell geometry and MreB localization may maintain elongated cell shape by targeting cell wall growth to regions of negative cell wall curvature']"	"mreB"	"[{'identifier': 'GO:0000902', 'name': 'cell morphogenesis', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"D9RZV6_THEOJ"	"f1ce741a32f1c95a7e3198eb4e4c5aa1ba4f93f0"	True	False	False	332	"Cell shape-determining protein MreB"	3	"UP000000272"	"MDIGIDLGTASILVYVRGKGIVLQEPSVVALDKDTGEVLAVGEQARKMIGRTPGNIVAIRPLRAGVIADYTVTELMLKHFLKKVIQRKLFRPRVMVCVPAVITEVEKRAVIEAATAAGARQTFLIEEPIAAAIGAGLDISKPVGSMVVDIGGGTTDIAVLSLGGIVCGTSIRVAGDMFDEAIVKYVKKEFNLAIGERTAEEVKISLATVFPDADSSKSLEIRGRSLISGLPQTVTITARQTCEALQEPVERIIEAIFSVLEKTPPELAADISERGIVMTGGGSLLNGLDKLIAQRTNMPVYVAEDAVSCVALGAGKALECLDMLGPNAVYKK"	"unreviewed"	"{'taxId': '555079', 'scientificName': 'Thermosediminibacter oceani (strain ATCC BAA-1034 / DSM 16646 / JW/IW-1228P)', 'fullName': 'Thermosediminibacter oceani (strain ATCC BAA-1034 / DSM 16646 / JW/IW-1228P)'}"
