General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D8IZ90",
        "id": "D8IZ90_HERSS",
        "source_organism": {
            "taxId": "757424",
            "scientificName": "Herbaspirillum seropedicae (strain SmR1)",
            "fullName": "Herbaspirillum seropedicae (strain SmR1)"
        },
        "name": "Protein TonB",
        "description": [
            "Interacts with outer membrane receptor proteins that carry out high-affinity binding and energy dependent uptake into the periplasmic space of specific substrates. It could act to transduce energy from the cytoplasmic membrane to specific energy-requiring processes in the outer membrane, resulting in the release into the periplasm of ligands bound by these outer membrane proteins"
        ],
        "length": 232,
        "sequence": "MNATSPLLMSMSPPSALMRQARKIGPLGLIILLHIAFFWALQSGLVKQAVNAVPKEVIATFIVPEKAPEPAPPKAQPAPPKEVKIVKKAVTPPKPIPVTETPAPTAITAPPQPPQPAAPAPQVAAEPTPAPAAPPGPVLPKQITSGIEYIERPNPTYPSVSRRMGEEGVVEFRVTVNTSGRAEKVEITKSSGYSRLDDAARNAIMRAVFKPYIENGKAITVSTVGSLAFRLN",
        "proteome": "UP000000329",
        "gene": "tonB",
        "go_terms": [
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0031992",
                "name": "energy transducer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015891",
                "name": "siderophore transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030288",
                "name": "outer membrane-bounded periplasmic space",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c87e398a29edf17e2ac7ad81e99e7c6009fe5f90",
        "counters": {
            "domain_architectures": 37850,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 37850
        }
    }
}