"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D8IZ90"	"{'domain_architectures': 37850, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'ncbifam': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 37850}"	"['Interacts with outer membrane receptor proteins that carry out high-affinity binding and energy dependent uptake into the periplasmic space of specific substrates. It could act to transduce energy from the cytoplasmic membrane to specific energy-requiring processes in the outer membrane, resulting in the release into the periplasm of ligands bound by these outer membrane proteins']"	"tonB"	"[{'identifier': 'GO:0055085', 'name': 'transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0031992', 'name': 'energy transducer activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0015891', 'name': 'siderophore transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0030288', 'name': 'outer membrane-bounded periplasmic space', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"D8IZ90_HERSS"	"c87e398a29edf17e2ac7ad81e99e7c6009fe5f90"	True	False	False	232	"Protein TonB"	3	"UP000000329"	"MNATSPLLMSMSPPSALMRQARKIGPLGLIILLHIAFFWALQSGLVKQAVNAVPKEVIATFIVPEKAPEPAPPKAQPAPPKEVKIVKKAVTPPKPIPVTETPAPTAITAPPQPPQPAAPAPQVAAEPTPAPAAPPGPVLPKQITSGIEYIERPNPTYPSVSRRMGEEGVVEFRVTVNTSGRAEKVEITKSSGYSRLDDAARNAIMRAVFKPYIENGKAITVSTVGSLAFRLN"	"unreviewed"	"{'taxId': '757424', 'scientificName': 'Herbaspirillum seropedicae (strain SmR1)', 'fullName': 'Herbaspirillum seropedicae (strain SmR1)'}"
