General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D7R609",
        "id": "D7R609_EPICO",
        "source_organism": {
            "taxId": "94232",
            "scientificName": "Epinephelus coioides",
            "fullName": "Epinephelus coioides (Orange-spotted grouper)"
        },
        "name": "Dicarboxylate carrier UCP2",
        "description": [
            "Antiporter that exports dicarboxylate intermediates of the Krebs cycle in exchange for phosphate plus a proton across the inner membrane of mitochondria, a process driven by mitochondrial motive force with an overall impact on glycolysis, glutaminolysis and glutathione-dependent redox balance. Continuous export of oxaloacetate and related four-carbon dicarboxylates from mitochondrial matrix into the cytosol negatively regulates the oxidation of acetyl-CoA substrates via the Krebs cycle, lowering the ATP/ADP ratio and reactive oxygen species (ROS) production. May mediate inducible proton entry into the mitochondrial matrix affecting ATP turnover as a protection mechanism against oxidative stress. The proton currents are most likely associated with fatty acid flipping across the inner membrane of mitochondria in a metabolic process regulated by free fatty acids and purine nucleotides"
        ],
        "length": 312,
        "sequence": "MVGFGPADVPPSAAVKFVGAGTAGCIADLVTFPLDTAKVRLQIQGEARAPVAAGKEYAVKYRGVFGTITTMVRTEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHVGIGSRLLAGCTTGAMAVAFAQPTDVVKVRFQAQARSPGCVRRYCSTVNAYKTIAKEEGIHGLWKGTAPNIARNAIVNCTELVTYDFIKDTLLRSTPLTDNLPCHFVSAFGAGLCTTVIASPVDVVKTRYMNAALSQYSSVLKCAAAMMTKEGPLAFYKGFMPSFLRLGSWNVVMFVTYEQLKRAMMAANHNCTTIL",
        "proteome": null,
        "gene": "UCP2",
        "go_terms": [
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e037822792ef5f5d7967370632f8bf737b916266",
        "counters": {
            "domain_architectures": 140476,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "pfam": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 140476
        }
    }
}