"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D7R609"	"{'domain_architectures': 140476, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'pfam': 1, 'ssf': 1, 'cathgene3d': 1, 'panther': 1, 'prints': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 140476}"	"['Antiporter that exports dicarboxylate intermediates of the Krebs cycle in exchange for phosphate plus a proton across the inner membrane of mitochondria, a process driven by mitochondrial motive force with an overall impact on glycolysis, glutaminolysis and glutathione-dependent redox balance. Continuous export of oxaloacetate and related four-carbon dicarboxylates from mitochondrial matrix into the cytosol negatively regulates the oxidation of acetyl-CoA substrates via the Krebs cycle, lowering the ATP/ADP ratio and reactive oxygen species (ROS) production. May mediate inducible proton entry into the mitochondrial matrix affecting ATP turnover as a protection mechanism against oxidative stress. The proton currents are most likely associated with fatty acid flipping across the inner membrane of mitochondria in a metabolic process regulated by free fatty acids and purine nucleotides']"	"UCP2"	"[{'identifier': 'GO:0055085', 'name': 'transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"D7R609_EPICO"	"e037822792ef5f5d7967370632f8bf737b916266"	True	False	False	312	"Dicarboxylate carrier UCP2"	2	""	"MVGFGPADVPPSAAVKFVGAGTAGCIADLVTFPLDTAKVRLQIQGEARAPVAAGKEYAVKYRGVFGTITTMVRTEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHVGIGSRLLAGCTTGAMAVAFAQPTDVVKVRFQAQARSPGCVRRYCSTVNAYKTIAKEEGIHGLWKGTAPNIARNAIVNCTELVTYDFIKDTLLRSTPLTDNLPCHFVSAFGAGLCTTVIASPVDVVKTRYMNAALSQYSSVLKCAAAMMTKEGPLAFYKGFMPSFLRLGSWNVVMFVTYEQLKRAMMAANHNCTTIL"	"unreviewed"	"{'taxId': '94232', 'scientificName': 'Epinephelus coioides', 'fullName': 'Epinephelus coioides (Orange-spotted grouper)'}"