General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D5GCI5",
        "id": "D5GCI5_TUBMM",
        "source_organism": {
            "taxId": "656061",
            "scientificName": "Tuber melanosporum (strain Mel28)",
            "fullName": "Tuber melanosporum (strain Mel28) (Perigord black truffle)"
        },
        "name": "Cytochrome c oxidase subunit",
        "description": [
            "Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation"
        ],
        "length": 86,
        "sequence": "MSDEERETKPFKFVTAGFDARFPHQNQTKHCWQNYVDYHKCIIAKGEDFAPCKQFYLAYRSLCPNSWIDRWDTQRENGNFPVKLDS",
        "proteome": "UP000006911",
        "gene": "GSTUM_00005904001",
        "go_terms": [
            {
                "identifier": "GO:0005739",
                "name": "mitochondrion",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0045277",
                "name": "respiratory chain complex IV",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "47f14feebe98f947465af62e1db23d5486a861d3",
        "counters": {
            "domain_architectures": 9295,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "pirsf": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 9295
        }
    }
}