"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D5GCI5"	"{'domain_architectures': 9295, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'ssf': 1, 'pfam': 1, 'profile': 1, 'panther': 1, 'pirsf': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 9295}"	"['Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation']"	"GSTUM_00005904001"	"[{'identifier': 'GO:0005739', 'name': 'mitochondrion', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0045277', 'name': 'respiratory chain complex IV', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"D5GCI5_TUBMM"	"47f14feebe98f947465af62e1db23d5486a861d3"	True	False	False	86	"Cytochrome c oxidase subunit"	3	"UP000006911"	"MSDEERETKPFKFVTAGFDARFPHQNQTKHCWQNYVDYHKCIIAKGEDFAPCKQFYLAYRSLCPNSWIDRWDTQRENGNFPVKLDS"	"unreviewed"	"{'taxId': '656061', 'scientificName': 'Tuber melanosporum (strain Mel28)', 'fullName': 'Tuber melanosporum (strain Mel28) (Perigord black truffle)'}"