HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D4VDI1",
"id": "D4VDI1_PHOVU",
"source_organism": {
"taxId": "702446",
"scientificName": "Phocaeicola vulgatus PC510",
"fullName": "Phocaeicola vulgatus PC510"
},
"name": "Crossover junction endodeoxyribonuclease RuvC",
"description": [
"The RuvA-RuvB-RuvC complex processes Holliday junction (HJ) DNA during genetic recombination and DNA repair. Endonuclease that resolves HJ intermediates. Cleaves cruciform DNA by making single-stranded nicks across the HJ at symmetrical positions within the homologous arms, yielding a 5'-phosphate and a 3'-hydroxyl group; requires a central core of homology in the junction. The consensus cleavage sequence is 5'-(A/T)TT(C/G)-3'. Cleavage occurs on the 3'-side of the TT dinucleotide at the point of strand exchange. HJ branch migration catalyzed by RuvA-RuvB allows RuvC to scan DNA until it finds its consensus sequence, where it cleaves and resolves the cruciform DNA"
],
"length": 189,
"sequence": "MIQPVKEKIILGIDPGTTIMGYGLLKVVGTKPQVMTMGVIDLRKYGDHYLKLRRIFERVVGIIEAYLPDELAIEAPFFGKNVQSMLKLGRAQGVAMAAALSRDIPITEYAPLKIKMAITGNGQASKEQVADMLKRMLHIPESDMLPFMDATDGLAAAYCHYLQMGRPTLTKEYSGWKDFINKNPDKIKR",
"proteome": null,
"gene": "ruvC",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004520",
"name": "DNA endonuclease activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006281",
"name": "DNA repair",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006310",
"name": "DNA recombination",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008821",
"name": "crossover junction DNA endonuclease activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d60f1a9bedb8f81580f51119033923af5affee26",
"counters": {
"domain_architectures": 22245,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"cdd": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 1,
"prints": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 22245
}
}
}