"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D4VDI1"	"{'domain_architectures': 22245, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'cdd': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'prosite': 1, 'prints': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 22245}"	"[""The RuvA-RuvB-RuvC complex processes Holliday junction (HJ) DNA during genetic recombination and DNA repair. Endonuclease that resolves HJ intermediates. Cleaves cruciform DNA by making single-stranded nicks across the HJ at symmetrical positions within the homologous arms, yielding a 5'-phosphate and a 3'-hydroxyl group; requires a central core of homology in the junction. The consensus cleavage sequence is 5'-(A/T)TT(C/G)-3'. Cleavage occurs on the 3'-side of the TT dinucleotide at the point of strand exchange. HJ branch migration catalyzed by RuvA-RuvB allows RuvC to scan DNA until it finds its consensus sequence, where it cleaves and resolves the cruciform DNA""]"	"ruvC"	"[{'identifier': 'GO:0003676', 'name': 'nucleic acid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0004520', 'name': 'DNA endonuclease activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006281', 'name': 'DNA repair', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006310', 'name': 'DNA recombination', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0008821', 'name': 'crossover junction DNA endonuclease activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"D4VDI1_PHOVU"	"d60f1a9bedb8f81580f51119033923af5affee26"	True	False	False	189	"Crossover junction endodeoxyribonuclease RuvC"	3	""	"MIQPVKEKIILGIDPGTTIMGYGLLKVVGTKPQVMTMGVIDLRKYGDHYLKLRRIFERVVGIIEAYLPDELAIEAPFFGKNVQSMLKLGRAQGVAMAAALSRDIPITEYAPLKIKMAITGNGQASKEQVADMLKRMLHIPESDMLPFMDATDGLAAAYCHYLQMGRPTLTKEYSGWKDFINKNPDKIKR"	"unreviewed"	"{'taxId': '702446', 'scientificName': 'Phocaeicola vulgatus PC510', 'fullName': 'Phocaeicola vulgatus PC510'}"
