General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D4I5I0",
        "id": "D4I5I0_ASFE7",
        "source_organism": {
            "taxId": "686262",
            "scientificName": "African swine fever virus (isolate Pig/Spain/E-75/1975)",
            "fullName": "African swine fever virus (isolate Pig/Spain/E-75/1975) (ASFV)"
        },
        "name": "Protein DP71L",
        "description": [
            "Interacts with the host phosphatase PP1 catalytic subunit (PPP1CB) and recruits it to dephosphorylate EIF2S1/eIF2alpha and therefore restores the host translation that has been shut-down by the host. Also inhibits the EIF2S1/eIF2alpha-ATF4-DDIT3/CHOP pathway"
        ],
        "length": 71,
        "sequence": "MGGRRRKKRTNDTKHVRFAAAVEVWEADDIERKGPWEQVAVDRFRFQRRIASVEELLSTVLLRQKKLLEQQ",
        "proteome": null,
        "gene": "BA71V-DP71L (l14L/ NLS)",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "c94e05e71480448269f316eabd6f6af5b61b4cb6",
        "counters": {
            "domain_architectures": 869,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 869
        }
    }
}