"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D4I5I0"	"{'domain_architectures': 869, 'entries': 4, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 869}"	"['Interacts with the host phosphatase PP1 catalytic subunit (PPP1CB) and recruits it to dephosphorylate EIF2S1/eIF2alpha and therefore restores the host translation that has been shut-down by the host. Also inhibits the EIF2S1/eIF2alpha-ATF4-DDIT3/CHOP pathway']"	"BA71V-DP71L (l14L/ NLS)"	""	"D4I5I0_ASFE7"	"c94e05e71480448269f316eabd6f6af5b61b4cb6"	False	False	False	71	"Protein DP71L"	3	""	"MGGRRRKKRTNDTKHVRFAAAVEVWEADDIERKGPWEQVAVDRFRFQRRIASVEELLSTVLLRQKKLLEQQ"	"unreviewed"	"{'taxId': '686262', 'scientificName': 'African swine fever virus (isolate Pig/Spain/E-75/1975)', 'fullName': 'African swine fever virus (isolate Pig/Spain/E-75/1975) (ASFV)'}"