GET /api/protein/UniProt/D2ZWP6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D2ZWP6",
"id": "D2ZWP6_NEIM2",
"source_organism": {
"taxId": "546266",
"scientificName": "Neisseria mucosa (strain ATCC 25996 / DSM 4631 / NCTC 10774 / M26)",
"fullName": "Neisseria mucosa (strain ATCC 25996 / DSM 4631 / NCTC 10774 / M26)"
},
"name": "Leucyl/phenylalanyl-tRNA--protein transferase",
"description": [
"Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine"
],
"length": 241,
"sequence": "MSIPLLYPNDYTFPDPFYALEERDGLVGISRDLDTGRLLSAYRQGIFPWFSEDGWFFWYTIDPRAVIVPENLHIGRSLAKTLRNKPYRVTVNQCFETVIAHCAAFPRPGQDGTWIVPEFQAAYTELHRLGHAHSFECFYPDETGRLKLAGGFYGVQIGRVFYGESMFALEPDASKIAFARAVPFLAGLGIELIDCQQDTLHMHRFGSEPIPFVEFQTTLQRLNVLPLKEAFGARVVGGTLE",
"proteome": null,
"gene": "aat",
"go_terms": [
{
"identifier": "GO:0008914",
"name": "leucyl-tRNA--protein transferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0030163",
"name": "protein catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e96ae7594d271ca9661d28c50fa789d45ac52490",
"counters": {
"domain_architectures": 13656,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"hamap": 1,
"panther": 1,
"pfam": 1,
"ncbifam": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 13656
}
}
}