General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D2ZWP6",
        "id": "D2ZWP6_NEIM2",
        "source_organism": {
            "taxId": "546266",
            "scientificName": "Neisseria mucosa (strain ATCC 25996 / DSM 4631 / NCTC 10774 / M26)",
            "fullName": "Neisseria mucosa (strain ATCC 25996 / DSM 4631 / NCTC 10774 / M26)"
        },
        "name": "Leucyl/phenylalanyl-tRNA--protein transferase",
        "description": [
            "Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine"
        ],
        "length": 241,
        "sequence": "MSIPLLYPNDYTFPDPFYALEERDGLVGISRDLDTGRLLSAYRQGIFPWFSEDGWFFWYTIDPRAVIVPENLHIGRSLAKTLRNKPYRVTVNQCFETVIAHCAAFPRPGQDGTWIVPEFQAAYTELHRLGHAHSFECFYPDETGRLKLAGGFYGVQIGRVFYGESMFALEPDASKIAFARAVPFLAGLGIELIDCQQDTLHMHRFGSEPIPFVEFQTTLQRLNVLPLKEAFGARVVGGTLE",
        "proteome": null,
        "gene": "aat",
        "go_terms": [
            {
                "identifier": "GO:0008914",
                "name": "leucyl-tRNA--protein transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030163",
                "name": "protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e96ae7594d271ca9661d28c50fa789d45ac52490",
        "counters": {
            "domain_architectures": 13656,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "ncbifam": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 13656
        }
    }
}