"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D2ZWP6"	"{'domain_architectures': 13656, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 2, 'hamap': 1, 'panther': 1, 'pfam': 1, 'ncbifam': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 13656}"	"['Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine']"	"aat"	"[{'identifier': 'GO:0008914', 'name': 'leucyl-tRNA--protein transferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0030163', 'name': 'protein catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"D2ZWP6_NEIM2"	"e96ae7594d271ca9661d28c50fa789d45ac52490"	True	False	False	241	"Leucyl/phenylalanyl-tRNA--protein transferase"	3	""	"MSIPLLYPNDYTFPDPFYALEERDGLVGISRDLDTGRLLSAYRQGIFPWFSEDGWFFWYTIDPRAVIVPENLHIGRSLAKTLRNKPYRVTVNQCFETVIAHCAAFPRPGQDGTWIVPEFQAAYTELHRLGHAHSFECFYPDETGRLKLAGGFYGVQIGRVFYGESMFALEPDASKIAFARAVPFLAGLGIELIDCQQDTLHMHRFGSEPIPFVEFQTTLQRLNVLPLKEAFGARVVGGTLE"	"unreviewed"	"{'taxId': '546266', 'scientificName': 'Neisseria mucosa (strain ATCC 25996 / DSM 4631 / NCTC 10774 / M26)', 'fullName': 'Neisseria mucosa (strain ATCC 25996 / DSM 4631 / NCTC 10774 / M26)'}"