General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D1MGU1",
        "id": "SLB_PROJR",
        "source_organism": {
            "taxId": "242841",
            "scientificName": "Protobothrops jerdonii",
            "fullName": "Protobothrops jerdonii (Jerdon's pitviper)"
        },
        "name": "Snaclec jerdonibitin subunit beta",
        "description": [
            "Snaclec that dose-dependently inhibits platelet aggregation induced by ristocetin or low-dose thrombin, but not by high-dose thrombin. Binds to GPIbalpha (GP1BA). In vivo, also dose-dependently induces thrombocytopenia of mice and platelet counts remains at very low level even after 18 hours intravenous injection"
        ],
        "length": 146,
        "sequence": "MGRFIFVSFGLLVVFLSLSGTGADCPSDWSSYEGHCYRVFQQQMNWADAEKFCTQQRKESHLVSFESSEEVDFVVSKTFPILKENFVWIGLSNVWNGCRLQWSDGTELKYNAWSAESECIASKTTDNQWWSMDCSKTYPFVCKLIV",
        "proteome": null,
        "gene": null,
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1cc9d00484b728ff431ced75fc3bb394a7e71b41",
        "counters": {
            "domain_architectures": 71987,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 71987
        }
    }
}