"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D1MGU1"	"{'domain_architectures': 71987, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 71987}"	"['Snaclec that dose-dependently inhibits platelet aggregation induced by ristocetin or low-dose thrombin, but not by high-dose thrombin. Binds to GPIbalpha (GP1BA). In vivo, also dose-dependently induces thrombocytopenia of mice and platelet counts remains at very low level even after 18 hours intravenous injection']"	""	""	"SLB_PROJR"	"1cc9d00484b728ff431ced75fc3bb394a7e71b41"	True	False	False	146	"Snaclec jerdonibitin subunit beta"	1	""	"MGRFIFVSFGLLVVFLSLSGTGADCPSDWSSYEGHCYRVFQQQMNWADAEKFCTQQRKESHLVSFESSEEVDFVVSKTFPILKENFVWIGLSNVWNGCRLQWSDGTELKYNAWSAESECIASKTTDNQWWSMDCSKTYPFVCKLIV"	"reviewed"	"{'taxId': '242841', 'scientificName': 'Protobothrops jerdonii', 'fullName': ""Protobothrops jerdonii (Jerdon's pitviper)""}"