GET /api/protein/UniProt/D1B5A2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D1B5A2",
"id": "D1B5A2_SULD5",
"source_organism": {
"taxId": "525898",
"scientificName": "Sulfurospirillum deleyianum (strain ATCC 51133 / DSM 6946 / 5175)",
"fullName": "Sulfurospirillum deleyianum (strain ATCC 51133 / DSM 6946 / 5175)"
},
"name": "Probable molybdenum cofactor guanylyltransferase",
"description": [
"Transfers a GMP moiety from GTP to Mo-molybdopterin (Mo-MPT) cofactor (Moco or molybdenum cofactor) to form Mo-molybdopterin guanine dinucleotide (Mo-MGD) cofactor"
],
"length": 191,
"sequence": "MPFIPLPLVIVAGGKSSRMGSDKALLPFGDFKTLTEYQLARLQPFFERLHVSTKTRDKFDFDASFIEDNTTYTEHSPLVALLSILEYVNKPVCILSVDTPFVTPEIFHALANNLKETTDAVIAVSPSSSHPLCAIYAPSMIAKIKHALQHHNHKMHHLLEQSKTHYVHFKEDAPFLNLNHPEDYAYAKERL",
"proteome": "UP000002222",
"gene": "mobA",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006777",
"name": "Mo-molybdopterin cofactor biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "11d7d8eda9c5d56b51893113958d75bb4dc607d3",
"counters": {
"domain_architectures": 43756,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 43756
}
}
}