"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D1B5A2"	"{'domain_architectures': 43756, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'cathgene3d': 1, 'pfam': 1, 'ssf': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 43756}"	"['Transfers a GMP moiety from GTP to Mo-molybdopterin (Mo-MPT) cofactor (Moco or molybdenum cofactor) to form Mo-molybdopterin guanine dinucleotide (Mo-MGD) cofactor']"	"mobA"	"[{'identifier': 'GO:0003824', 'name': 'catalytic activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006777', 'name': 'Mo-molybdopterin cofactor biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"D1B5A2_SULD5"	"11d7d8eda9c5d56b51893113958d75bb4dc607d3"	True	False	False	191	"Probable molybdenum cofactor guanylyltransferase"	3	"UP000002222"	"MPFIPLPLVIVAGGKSSRMGSDKALLPFGDFKTLTEYQLARLQPFFERLHVSTKTRDKFDFDASFIEDNTTYTEHSPLVALLSILEYVNKPVCILSVDTPFVTPEIFHALANNLKETTDAVIAVSPSSSHPLCAIYAPSMIAKIKHALQHHNHKMHHLLEQSKTHYVHFKEDAPFLNLNHPEDYAYAKERL"	"unreviewed"	"{'taxId': '525898', 'scientificName': 'Sulfurospirillum deleyianum (strain ATCC 51133 / DSM 6946 / 5175)', 'fullName': 'Sulfurospirillum deleyianum (strain ATCC 51133 / DSM 6946 / 5175)'}"
