General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C8YJ99",
        "id": "INH4_TABYA",
        "source_organism": {
            "taxId": "485572",
            "scientificName": "Tabanus yao",
            "fullName": "Tabanus yao (Horsefly)"
        },
        "name": "Tabinhibitin 4",
        "description": [
            "Inhibits platelet aggregation induced by all agonists tested (ADP, arachidonic acid, the thromboxane A2 analog U46619, thrombin, and snake venom snaclecs (TMVA that activates platelet through GPIB, and stejnulxin that specifically acts through GPVI (GP6))) (PubMed:19531497). May act by competing with fibrinogen for binding to glycoprotein IIb/IIIa (ITGA2B/ITGB3) (PubMed:19531497)"
        ],
        "length": 249,
        "sequence": "MTLNVYFVLLSPYSLQSVPLPLTMQVIVPRRGDHVGCRNAGFGAHCGSNPQTPKLHQEHIKMVLQKTNWLRGVVAEGSFCYPKAARMPVLVWDDDLANLASLHTKGCVTETNKCRSTERFRSPGQSSYEISGDTLPSAMDILNFALRDWYLQKDNLTRKDIGSYPAGEDKGLKNMANLISDKVTAIGCGLTHWEEGKLKRALFTCNFSSSNVPGHPIYQRGDNFATKCAKTHPYYKSLCNSDEHIKPNK",
        "proteome": null,
        "gene": null,
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c7289db9d32ff25647729668e6f64a2c9206161d",
        "counters": {
            "domain_architectures": 59198,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "cdd": 1,
                "pfam": 1,
                "pirsf": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 59198
        }
    }
}