"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C8YJ99"	"{'domain_architectures': 59198, 'entries': 9, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'cdd': 1, 'pfam': 1, 'pirsf': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 59198}"	"['Inhibits platelet aggregation induced by all agonists tested (ADP, arachidonic acid, the thromboxane A2 analog U46619, thrombin, and snake venom snaclecs (TMVA that activates platelet through GPIB, and stejnulxin that specifically acts through GPVI (GP6))) (PubMed:19531497). May act by competing with fibrinogen for binding to glycoprotein IIb/IIIa (ITGA2B/ITGB3) (PubMed:19531497)']"	""	""	"INH4_TABYA"	"c7289db9d32ff25647729668e6f64a2c9206161d"	True	False	False	249	"Tabinhibitin 4"	1	""	"MTLNVYFVLLSPYSLQSVPLPLTMQVIVPRRGDHVGCRNAGFGAHCGSNPQTPKLHQEHIKMVLQKTNWLRGVVAEGSFCYPKAARMPVLVWDDDLANLASLHTKGCVTETNKCRSTERFRSPGQSSYEISGDTLPSAMDILNFALRDWYLQKDNLTRKDIGSYPAGEDKGLKNMANLISDKVTAIGCGLTHWEEGKLKRALFTCNFSSSNVPGHPIYQRGDNFATKCAKTHPYYKSLCNSDEHIKPNK"	"reviewed"	"{'taxId': '485572', 'scientificName': 'Tabanus yao', 'fullName': 'Tabanus yao (Horsefly)'}"